tooltip layer (initially hidden)
signaling gateway home
Protein A003584
Author-entered Data
V1.0, Peer Reviewed
Published 17 May 2005
Automated Data
Not Reviewed
As At Publication
Automated Data
Not Reviewed
Latest from 6 Jun 2014

Rpn8

Basis Sequence: Mouse

Version 1.0, Peer Reviewed And Published 17 May 2005
Pfam Output retrieved 27 Apr 2005

doi:10.1038/mp.a003584.01  How to cite this Molecule Page

hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /misc/afcs/EXTERNAL_DATA/PFAM/Pfam_ls
Sequence file:            6754724.aa
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: gi|6754724|ref|NP_034947.1|
Accession:      [none]
Description:    proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 [Mus musculus]=:A003584:mouse

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
Mov34    Mov34/MPN/PAD-1 family                         169.5    7.4e-48   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
Mov34      1/1       4   118 ..     1   120 []   169.5  7.4e-48

Alignments of top-scoring domains:
Mov34: domain 1 of 1, from 4 to 118: score 169.5, E = 7.4e-48
                   *->ssvrtvkihplvllkildhaerggps..keevmGlLlGklegdgrvi
                       +v++v++hplvll+++dh++r g+ +++++v+G+LlG++ +   v+
  gi|6754724     4    LAVQKVVVHPLVLLSVVDHFNRIGKVgnQKRVVGVLLGSWQKK--VL 48   

                   evtnvFalpqeeteddvdaveldqeymekmlemlkkvngrgeevVGWYHS
                   +v n+Fa+p++e+++d+++++ld++y+e+m+ m+kkvn+r e++VGWYH+
  gi|6754724    49 DVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNAR-ERIVGWYHT 97   

                   HPglgcwlSevDvhtqelyqryipe<-*
                   +P+l    +++D+ ++el +ry+p+   
  gi|6754724    98 GPKL----HKNDIAINELMKRYCPN    118  

//