tooltip layer (initially hidden)
signaling gateway home
Protein A003584
Author-entered Data
V1.0, Peer Reviewed
Published 17 May 2005
Automated Data
Not Reviewed
As At Publication
Automated Data
Not Reviewed
Latest from 6 Jun 2014

Rpn8

Basis Sequence: Mouse

Latest pfam output retrieved 6 Jun 2014

doi:10.1038/mp.a003584.01  How to cite this Molecule Page

# hmmscan :: search sequence(s) against a profile database
# HMMER 3.0rc1 (February 2010); http://hmmer.org/
# Copyright (C) 2010 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             6754724.aa
# target HMM database:             /sgmp_z2pool/xdata/PFAM/Pfam-A.hmm
# profile reporting threshold:     E-value <= 0.1
# domain reporting threshold:      E-value <= 0.1
# profile inclusion threshold:     E-value <= 0.1
# number of worker threads:        8
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       gi|6754724|ref|NP_034947.1|  [L=321]
Description: 26S proteasome non-ATPase regulatory subunit 7 [Mus musculus]=:A003584:mouse
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    6.3e-40  135.8   0.3    1.8e-39  134.3   0.3    1.7  1  MitMem_reg Maintenance of mitochondrial structure and functi
    2.9e-30  104.3   0.0    2.9e-30  104.3   0.0    2.1  1  JAB        JAB1/Mov34/MPN/PAD-1 ubiquitin protease


Domain annotation for each model (and alignments):
>> MitMem_reg  Maintenance of mitochondrial structure and function
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  134.3   0.3   2.5e-43   1.8e-39       1     115 []     165     279 ..     165     279 .. 0.99

  Alignments for each domain:
  == domain 1    score: 134.3 bits;  conditional E-value: 2.5e-43
                   MitMem_reg   1 eEaeeigvehllrdlndqyysnlsrkleseqkmLknLhkklweiglyledveagklplnhsilrklqsllnllpnlnnkele 82 
                                  eEaee+gvehllrd++d+++++ls++++++ + Lk+L++kl +i  yle+v++gklp+nh+i+++lq+++nllp+ + +e+ 
  gi|6754724|ref|NP_034947.1| 165 EEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVASGKLPINHQIIYQLQDVFNLLPDASLQEFV 246
                                  7********************************************************************************* PP

                   MitMem_reg  83 eefnvetndellvvylgkldrkqialhelienk 115
                                  ++f+++tnd++ vvyl++l+r+++alh+li+nk
  gi|6754724|ref|NP_034947.1| 247 KAFYLKTNDQMVVVYLASLIRSVVALHNLINNK 279
                                  *******************************97 PP

>> JAB  JAB1/Mov34/MPN/PAD-1 ubiquitin protease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  104.3   0.0   3.9e-34   2.9e-30       2     113 ..       5     117 ..       4     118 .. 0.97

  Alignments for each domain:
  == domain 1    score: 104.3 bits;  conditional E-value: 3.9e-34
                                  TCEEEEEETTHHHHHHHHTHHHHHT....--EEEEEEEECSSEEE.EEEEEE--EEE-SS-EEE--H........HHHHHHH CS
                          JAB   2 svqavhleslvllkildhalrteke....evmGlliGelnddttveitnvfalprsetekdvdaveldqe..ekksellkkl 77 
                                  +vq+v++++lvll+++dh++r +k     +v+G+l+G+ +++ ++++ n+fa+p++e++kd+++++ld++  e+++ ++kk+
  gi|6754724|ref|NP_034947.1|   5 AVQKVVVHPLVLLSVVDHFNRIGKVgnqkRVVGVLLGSWQKK-VLDVSNSFAVPFDEDDKDDSVWFLDHDylENMYGMFKKV 85 
                                  79*******************99989999*************.*************************************** PP

                                  HTT-EEEEEEEE-SSS-S---HHHHHHHHHHHHH-T CS
                          JAB  78 rgrervVGWYhshphitvwlshvdvrtqamyqmmdq 113
                                  ++rer+VGWYh++p++    +++d+ ++++++++++
  gi|6754724|ref|NP_034947.1|  86 NARERIVGWYHTGPKL----HKNDIAINELMKRYCP 117
                                  ****************....************9987 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (321 residues)
Target model(s):                       14831  (2610332 nodes)
Passed MSV filter:                      1814  (0.122311); expected 296.6 (0.02)
Passed bias filter:                      730  (0.0492212); expected 296.6 (0.02)
Passed Vit filter:                       112  (0.00755175); expected 14.8 (0.001)
Passed Fwd filter:                         6  (0.000404558); expected 0.1 (1e-05)
Initial search space (Z):              14831  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 1.42u 0.34s 00:00:01.76 Elapsed: 00:00:00.75
# Mc/sec: 1117.22
//